PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa05g038340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GATA
Protein Properties Length: 274aa    MW: 30667 Da    PI: 7.0898
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa05g038340.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.92.1e-16201235135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C tt Tp+WR+gp g  tLCnaCG+++r+ +l
  Csa05g038340.1 201 CTHCETTRTPQWREGPCGRNTLCNACGVRFRSGRL 235
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.5E-15195245IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.61E-14199258No hitNo description
PROSITE profilePS5011411.939199231IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.7E-13199232IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.42E-14200249No hitNo description
PfamPF003202.6E-14201235IPR000679Zinc finger, GATA-type
PROSITE patternPS003440201226IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSNGSWLPEE DFKGLADNFF DNLVEHMDDF PLEDIETADD DEEEDWVTGF KNLGPPPLDV  60
LTSLSSEFNC KKQSSSSDVS STVDNSPPDV KVSKLFQSSS PVSVVDNTTN GSVLSQNQNR  120
IQRLAFLVKG IRSKRKRPTT LRFFQSLGAE MSQHFVPDES ESETYLSSES SAKKRKKNKS  180
RPAPSVSSPE LFNSDGTVRK CTHCETTRTP QWREGPCGRN TLCNACGVRF RSGRLVPEYR  240
PASSPTFIPT VHSNSHRKII EMKTRTERSE HRN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172176KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010510636.11e-179PREDICTED: putative GATA transcription factor 13
SwissprotQ9SKN61e-102GAT13_ARATH; Putative GATA transcription factor 13
TrEMBLR0FY421e-151R0FY42_9BRAS; Uncharacterized protein
STRINGscaffold_401176.11e-130(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28340.13e-77GATA transcription factor 13